HORDB

ID: hor006520
Uniprot ID: P01180
Protein name: Copeptin
Gene name: AVP
Organism: Bos taurus (Bovine)
Family: Vasopressin/oxytocin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
GO BP: GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence: ANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
Length: 39
Propeptide: MPDATLPACFLSLLAFTSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
Signal peptide: MPDATLPACFLSLLAFTSA
Modification: NA
Glycosylation: T6 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (By similarity).
Mechanism: Fetal neurophysin is the major neurophysin present in the neurohypophysis of 7 to 9 month fetuses and its sequence appears to be identical with that of the adult.
Cross BBB: NA
Target: AVPR2, AVPR1A
Target Unid: P48044, F6PV87
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006520_AF2.pdb

hor006520_ESM.pdb

Mass:	462144	Formula:	C173H281N49O56
Absent amino acids:	CFHIKMW	Common amino acids:	AL
pI:	4.11	Basic residues:	2
Polar residues:	10	Hydrophobic residues:	16
Hydrophobicity:	-6.67	Boman Index:	-3582
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	102.82
Instability Index:	5675.38	Extinction Coefficient cystines:	1490
Absorbance 280nm:	39.21

PubMed ID: 6276766
Title: Nucleotide sequence of cloned cDNA encoding bovine arginine vasopressin-neurophysin II precursor.
PubMed ID: 6709064
Title: Recent gene conversion involving bovine vasopressin and oxytocin precursor genes suggested by nucleotide sequence.
PubMed ID: 3768139
Title: The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation.
PubMed ID: 13115463
Title: [The structure of bovine vasopressin].
PubMed ID: 3318825
Title: Partial assignment of disulfide pairs in neurophysins.
PubMed ID: 1252249
Title: Amino acid sequence of bovine neurophysin-II: a reinvestigation.
PubMed ID: 1248642
Title: Foetal bovine MSEL-neurophysin: comparison with adult homologous neurophysin.
PubMed ID: 4564211
Title: Covalent structure of bovine neurophysin-II: localization of the disulfide bonds.
PubMed ID: 465021
Title: A new glycopeptide in pig, ox and sheep pituitary.
PubMed ID: 2034668
Title: Crystal structure of a bovine neurophysin II dipeptide complex at 2.8 A determined from the single-wavelength anomalous scattering signal of an incorporated iodine atom.
PubMed ID: 8564543
Title: Crystal structure of the neurophysin-oxytocin complex.